SCOPe 2.07: Domain d1fwza3: 1fwz A:148-223

Lineage for d1fwza3 (1fwz A:148-223)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d1fwza3: 1fwz A:148-223 [60079]
   Other proteins in same PDB: d1fwza1, d1fwza2
   complexed with so4, zn

Details for d1fwza3

PDB Entry: 1fwz, 2.3 Å

PDB Description: glu20ala dtxr

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1fwza3:

Sequence, based on SEQRES records:

>d1fwza3 b.34.1.2 (A:148-223) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtiri

Sequence, based on observed residues (ATOM records):

>d1fwza3 b.34.1.2 (A:148-223) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtiri

Timeline for d1fwza3:

• d1fwza3 first appeared in SCOP 1.57
  
• d1fwza3 appears in SCOPe 2.06
  
• d1fwza3 appears in the current release, SCOPe 2.08