![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (5 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries) Uniprot P33120 |
![]() | Domain d1fwza3: 1fwz A:148-223 [60079] Other proteins in same PDB: d1fwza1, d1fwza2 complexed with so4, zn |
PDB Entry: 1fwz (more details), 2.3 Å
SCOPe Domain Sequences for d1fwza3:
Sequence, based on SEQRES records: (download)
>d1fwza3 b.34.1.2 (A:148-223) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn gkdvellddlahtiri
>d1fwza3 b.34.1.2 (A:148-223) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk dvellddlahtiri
Timeline for d1fwza3: