Lineage for d1fwxd2 (1fwx D:10-451)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170720Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
  4. 170750Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 170751Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (1 protein)
  6. 170752Protein Nitrous oxide reductase, N-terminal domain [50976] (2 species)
  7. 170753Species Paracoccus denitrificans [TaxId:266] [63833] (1 PDB entry)
  8. 170757Domain d1fwxd2: 1fwx D:10-451 [60076]
    Other proteins in same PDB: d1fwxa1, d1fwxb1, d1fwxc1, d1fwxd1

Details for d1fwxd2

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans

SCOP Domain Sequences for d1fwxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxd2 b.69.3.1 (D:10-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans}
gsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvriher
tmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmkc
daileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdadk
wevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeieka
iaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtvl
dvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedair
ayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpend
qlidisgdkmvlvhdgptfaephdaiavhpsilsdik

SCOP Domain Coordinates for d1fwxd2:

Click to download the PDB-style file with coordinates for d1fwxd2.
(The format of our PDB-style files is described here.)

Timeline for d1fwxd2: