Lineage for d1fwxd1 (1fwx D:452-580)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303876Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 1303877Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 1303878Species Paracoccus denitrificans [TaxId:266] [63690] (1 PDB entry)
  8. 1303882Domain d1fwxd1: 1fwx D:452-580 [60075]
    Other proteins in same PDB: d1fwxa2, d1fwxb2, d1fwxc2, d1fwxd2
    complexed with ca, cl, cua, cuz

Details for d1fwxd1

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans
PDB Compounds: (D:) nitrous oxide reductase

SCOPe Domain Sequences for d1fwxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxd1 b.6.1.4 (D:452-580) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]}
svwdrndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegd
evtvivtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalh
memrgrmlvep

SCOPe Domain Coordinates for d1fwxd1:

Click to download the PDB-style file with coordinates for d1fwxd1.
(The format of our PDB-style files is described here.)

Timeline for d1fwxd1: