Lineage for d1fwxb1 (1fwx B:452-580)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 107100Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 107101Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 107102Species Paracoccus denitrificans [TaxId:266] [63690] (1 PDB entry)
  8. 107104Domain d1fwxb1: 1fwx B:452-580 [60071]
    Other proteins in same PDB: d1fwxa2, d1fwxb2, d1fwxc2, d1fwxd2

Details for d1fwxb1

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans

SCOP Domain Sequences for d1fwxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxb1 b.6.1.4 (B:452-580) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans}
svwdrndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegd
evtvivtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalh
memrgrmlvep

SCOP Domain Coordinates for d1fwxb1:

Click to download the PDB-style file with coordinates for d1fwxb1.
(The format of our PDB-style files is described here.)

Timeline for d1fwxb1: