Lineage for d1fwwa_ (1fww A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins) Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (2 species) Species Aquifex aeolicus [TaxId:63363] [63922] (10 PDB entries) 
Domain d1fwwa_: 1fww A: [60067]
Details for d1fwwa_
PDB Entry: 1fww (more details), 1.85 Å
PDB Description: aquifex aeolicus kdo8p synthase in complex with pep, a5p and cadmium
SCOP Domain Sequences for d1fwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwwa_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti
SCOP Domain Coordinates for d1fwwa_:
Click to download the PDB-style file with coordinates for d1fwwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fwwa_:
- d1fwwa_ first appeared in SCOP 1.57
- d1fwwa_ appears in SCOP 1.61
- d1fwwa_ appears in the current release, SCOPe 2.08
View in 3D
