SCOPe 2.03: Domain d1fwta_: 1fwt A:

Lineage for d1fwta_ (1fwt A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (4 species)

7. Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries)

8. Domain d1fwta_: 1fwt A: [60065]
   complexed with cd, e4p, pep, po4

Details for d1fwta_

PDB Entry: 1fwt, 1.9 Å

PDB Description: aquifex aeolicus kdo8p synthase in complex with pep, e4p and cadmium

PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d1fwta_:

Sequence; same for both SEQRES and ATOM records:

>d1fwta_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Timeline for d1fwta_:

• d1fwta_ first appeared in SCOP 1.57
  
• d1fwta_ appears in SCOPe 2.02
  
• d1fwta_ appears in SCOPe 2.04
  
• d1fwta_ appears in the current release, SCOPe 2.08