Lineage for d1fw8a_ (1fw8 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily) Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) 
Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein) Protein Phosphoglycerate kinase [53750] (5 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53751] (3 PDB entries) 
Domain d1fw8a_: 1fw8 A: [60058]
Details for d1fw8a_
PDB Entry: 1fw8 (more details), 2.3 Å
PDB Description: circularly permuted phosphoglycerate kinase from yeast: pgk p72
SCOP Domain Sequences for d1fw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw8a_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae)}
skyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenlryhieeegsrk
vdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpqraagfllekel
kyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaftfkkvlenteig
dsifdkagaeivpklmekakakgvevvlpvdfiiadafsadantktvtdkegipagwqgl
dngpesrklfaatvakaktivwngppgvfefekfaagtkalldevvkssaagntviiggg
dtatvakkygvtdkishvstgggaslellegkelpgvaflsekkslssklsvqdldlkdk
rvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvlashlgrpngern
SCOP Domain Coordinates for d1fw8a_:
Click to download the PDB-style file with coordinates for d1fw8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fw8a_:
- d1fw8a_ is new in SCOP 1.57
- d1fw8a_ appears in SCOP 1.59
- d1fw8a_ appears in the current release, SCOPe 2.08, called d1fw8a1
View in 3D