Lineage for d1fw8a_ (1fw8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141951Protein Phosphoglycerate kinase [53750] (8 species)
  7. 2141954Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53751] (3 PDB entries)
  8. 2141957Domain d1fw8a_: 1fw8 A: [60058]
    Artificial circular permutation
    complexed with gol

Details for d1fw8a_

PDB Entry: 1fw8 (more details), 2.3 Å

PDB Description: circularly permuted phosphoglycerate kinase from yeast: pgk p72
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d1fw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw8a_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenlryhieeegsrk
vdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpqraagfllekel
kyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaftfkkvlenteig
dsifdkagaeivpklmekakakgvevvlpvdfiiadafsadantktvtdkegipagwqgl
dngpesrklfaatvakaktivwngppgvfefekfaagtkalldevvkssaagntviiggg
dtatvakkygvtdkishvstgggaslellegkelpgvaflsekkslssklsvqdldlkdk
rvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvlashlgrpngern

SCOPe Domain Coordinates for d1fw8a_:

Click to download the PDB-style file with coordinates for d1fw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fw8a_: