Lineage for d1fw4a_ (1fw4 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640930Protein Calmodulin [47516] (10 species)
  7. 640956Species Cow (Bos taurus) [TaxId:9913] [47518] (25 PDB entries)
  8. 640958Domain d1fw4a_: 1fw4 A: [60056]
    C-terminal domain
    complexed with ca

Details for d1fw4a_

PDB Entry: 1fw4 (more details), 1.7 Å

PDB Description: crystal structure of e. coli fragment tr2c from calmodulin to 1.7 a resolution
PDB Compounds: (A:) calmodulin

SCOP Domain Sequences for d1fw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
seeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyee
fvqmm

SCOP Domain Coordinates for d1fw4a_:

Click to download the PDB-style file with coordinates for d1fw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fw4a_: