SCOPe 2.05: Domain d1fw1a2: 1fw1 A:5-87

Lineage for d1fw1a2 (1fw1 A:5-87)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class zeta GST [81364] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64058] (1 PDB entry)
   maleylacetoacetate isomerase

8. Domain d1fw1a2: 1fw1 A:5-87 [60052]
   Other proteins in same PDB: d1fw1a1
   complexed with dtt, gsh, so4

Details for d1fw1a2

PDB Entry: 1fw1, 1.9 Å

PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase

PDB Compounds: (A:) glutathione transferase zeta

SCOPe Domain Sequences for d1fw1a2:

Sequence; same for both SEQRES and ATOM records:

>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}
kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki
dgitihqslaiieyleetrptpr

Timeline for d1fw1a2:

• d1fw1a2 first appeared in SCOP 1.57
  
• d1fw1a2 appears in SCOPe 2.04
  
• d1fw1a2 appears in SCOPe 2.06
  
• d1fw1a2 appears in the current release, SCOPe 2.08