Lineage for d1fvsa_ (1fvs A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80583Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 80584Family d.58.17.1: Metal-binding domain [55009] (6 proteins)
  6. 80607Protein Copper transporter domain ccc2a [64279] (1 species)
  7. 80608Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (2 PDB entries)
  8. 80610Domain d1fvsa_: 1fvs A: [60049]

Details for d1fvsa_

PDB Entry: 1fvs (more details)

PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) load states

SCOP Domain Sequences for d1fvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvsa_ d.58.17.1 (A:) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae)}
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds

SCOP Domain Coordinates for d1fvsa_:

Click to download the PDB-style file with coordinates for d1fvsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fvsa_: