Lineage for d1fvsa_ (1fvs A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.17: Metal-binding domain [55008] (1 family) 
Family d.58.17.1: Metal-binding domain [55009] (6 proteins) 
Protein Copper transporter domain ccc2a [64279] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (2 PDB entries) 
Domain d1fvsa_: 1fvs A: [60049]
Details for d1fvsa_
PDB Entry: 1fvs (more details)
PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) load states
SCOP Domain Sequences for d1fvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvsa_ d.58.17.1 (A:) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae)}
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds
SCOP Domain Coordinates for d1fvsa_:
Click to download the PDB-style file with coordinates for d1fvsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvsa_:
- d1fvsa_ is new in SCOP 1.57
- d1fvsa_ appears in SCOP 1.59
- d1fvsa_ appears in the current release, SCOPe 2.08, called d1fvsa1
View in 3D