SCOPe 2.08: Domain d1fvsa1: 1fvs A:2-72

Lineage for d1fvsa1 (1fvs A:2-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Copper transporter domain ccc2a [64279] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries)

8. Domain d1fvsa1: 1fvs A:2-72 [60049]
   Other proteins in same PDB: d1fvsa2
   Cu(I) form
   complexed with cu

Details for d1fvsa1

PDB Entry: 1fvs

PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) load states

PDB Compounds: (A:) copper-transporting ATPase

SCOPe Domain Sequences for d1fvsa1:

Sequence; same for both SEQRES and ATOM records:

>d1fvsa1 d.58.17.1 (A:2-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
revilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiied
cgfdceilrds

Timeline for d1fvsa1:

• d1fvsa1 first appeared in SCOP 1.57, called d1fvsa_
  
• d1fvsa1 appears in SCOPe 2.07