| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
| Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
| Protein Copper transporter domain ccc2a [64279] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries) |
| Domain d1fvqa1: 1fvq A:2-72 [60046] Other proteins in same PDB: d1fvqa2 apo form |
PDB Entry: 1fvq (more details)
SCOPe Domain Sequences for d1fvqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvqa1 d.58.17.1 (A:2-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
revilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiied
cgfdceilrds
Timeline for d1fvqa1: