Lineage for d1fvqa_ (1fvq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910056Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1910122Protein Copper transporter domain ccc2a [64279] (1 species)
  7. 1910123Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries)
  8. 1910125Domain d1fvqa_: 1fvq A: [60046]
    apo form

Details for d1fvqa_

PDB Entry: 1fvq (more details)

PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
PDB Compounds: (A:) copper-transporting ATPase

SCOPe Domain Sequences for d1fvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvqa_ d.58.17.1 (A:) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds

SCOPe Domain Coordinates for d1fvqa_:

Click to download the PDB-style file with coordinates for d1fvqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fvqa_: