![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: Metal-binding domain [55008] (1 family) ![]() |
![]() | Family d.58.17.1: Metal-binding domain [55009] (8 proteins) |
![]() | Protein Copper transporter domain ccc2a [64279] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (2 PDB entries) |
![]() | Domain d1fvqa_: 1fvq A: [60046] apo form |
PDB Entry: 1fvq (more details)
SCOP Domain Sequences for d1fvqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvqa_ d.58.17.1 (A:) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae)} arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie dcgfdceilrds
Timeline for d1fvqa_: