Lineage for d1fvqa_ (1fvq A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329525Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 329526Family d.58.17.1: Metal-binding domain [55009] (8 proteins)
  6. 329551Protein Copper transporter domain ccc2a [64279] (1 species)
  7. 329552Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (2 PDB entries)
  8. 329553Domain d1fvqa_: 1fvq A: [60046]
    apo form

Details for d1fvqa_

PDB Entry: 1fvq (more details)

PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states

SCOP Domain Sequences for d1fvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvqa_ d.58.17.1 (A:) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae)}
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds

SCOP Domain Coordinates for d1fvqa_:

Click to download the PDB-style file with coordinates for d1fvqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fvqa_: