Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Ornithine transcarbamoylase [53676] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries) |
Domain d1fvoa2: 1fvo A:185-354 [60043] complexed with cp |
PDB Entry: 1fvo (more details), 2.6 Å
SCOPe Domain Sequences for d1fvoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvoa2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} slkgltlswigdgnnilhsimmsaakfgmhlqaatpkgyepdasvtklaeqyakengtkl lltndpleaahggnvlitdtwismgreeekkkrlqafqgyqvtmktakvaasdwtflhcl prkpeevddevfysprslvfpeaenrkwtimavmvslltdyspqlqkpkf
Timeline for d1fvoa2: