Lineage for d1fvoa1 (1fvo A:34-184)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708619Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 708620Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 708621Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 708835Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 708872Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries)
  8. 708879Domain d1fvoa1: 1fvo A:34-184 [60042]

Details for d1fvoa1

PDB Entry: 1fvo (more details), 2.6 Å

PDB Description: crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate
PDB Compounds: (A:) ornithine transcarbamylase

SCOP Domain Sequences for d1fvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvoa1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]}
kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
easipiinglsdlyhpiqiladyltlqehys

SCOP Domain Coordinates for d1fvoa1:

Click to download the PDB-style file with coordinates for d1fvoa1.
(The format of our PDB-style files is described here.)

Timeline for d1fvoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvoa2