SCOP 1.65: Domain d1fv3b2: 1fv3 B:1111-1315

Lineage for d1fv3b2 (1fv3 B:1111-1315)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (2 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
   overall fold is very similar to that of the STI family

6. Protein Tetanus neurotoxin [50400] (1 species)

7. Species Clostridium tetani [50401] (8 PDB entries)

8. Domain d1fv3b2: 1fv3 B:1111-1315 [60041]
   Other proteins in same PDB: d1fv3a1, d1fv3b1
   complexed with ceq, gal, glc, nan, nga, po4, slb

Details for d1fv3b2

PDB Entry: 1fv3, 2.3 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b

SCOP Domain Sequences for d1fv3b2:

Sequence; same for both SEQRES and ATOM records:

>d1fv3b2 b.42.4.2 (B:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d1fv3b2:

• d1fv3b2 first appeared in SCOP 1.57
  
• d1fv3b2 appears in SCOP 1.63
  
• d1fv3b2 appears in SCOP 1.67
  
• d1fv3b2 appears in the current release, SCOPe 2.08