Lineage for d1fv3b1 (1fv3 B:865-1110)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119189Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 1119211Protein Tetanus neurotoxin [49957] (1 species)
  7. 1119212Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)
  8. 1119221Domain d1fv3b1: 1fv3 B:865-1110 [60040]
    Other proteins in same PDB: d1fv3a2, d1fv3b2
    complexed with ceq, po4

Details for d1fv3b1

PDB Entry: 1fv3 (more details), 2.3 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b
PDB Compounds: (B:) tetanus toxin heavy chain

SCOPe Domain Sequences for d1fv3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv3b1 b.29.1.6 (B:865-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
ytsyls

SCOPe Domain Coordinates for d1fv3b1:

Click to download the PDB-style file with coordinates for d1fv3b1.
(The format of our PDB-style files is described here.)

Timeline for d1fv3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fv3b2