Lineage for d1fv3a2 (1fv3 A:1111-1315)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 801105Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 801140Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 801162Protein Tetanus neurotoxin [50400] (1 species)
  7. 801163Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries)
  8. 801173Domain d1fv3a2: 1fv3 A:1111-1315 [60039]
    Other proteins in same PDB: d1fv3a1, d1fv3b1

Details for d1fv3a2

PDB Entry: 1fv3 (more details), 2.3 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b
PDB Compounds: (A:) tetanus toxin heavy chain

SCOP Domain Sequences for d1fv3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv3a2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1fv3a2:

Click to download the PDB-style file with coordinates for d1fv3a2.
(The format of our PDB-style files is described here.)

Timeline for d1fv3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fv3a1