![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein Tetanus neurotoxin [49957] (1 species) |
![]() | Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries) |
![]() | Domain d1fv2a1: 1fv2 A:865-1110 [60036] Other proteins in same PDB: d1fv2a2 complexed with ceq, po4 |
PDB Entry: 1fv2 (more details), 2.5 Å
SCOPe Domain Sequences for d1fv2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv2a1 b.29.1.6 (A:865-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl ytsyls
Timeline for d1fv2a1: