SCOP 1.73: Domain d1fv2a1: 1fv2 A:865-1110

Lineage for d1fv2a1 (1fv2 A:865-1110)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)

6. Protein Tetanus neurotoxin [49957] (1 species)

7. Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)

8. Domain d1fv2a1: 1fv2 A:865-1110 [60036]
   Other proteins in same PDB: d1fv2a2
   complexed with ceq, gal, glc, nan, nga, po4, slb

Details for d1fv2a1

PDB Entry: 1fv2, 2.5 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b

PDB Compounds: (A:) tetanus toxin heavy chain

SCOP Domain Sequences for d1fv2a1:

Sequence; same for both SEQRES and ATOM records:

>d1fv2a1 b.29.1.6 (A:865-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
ytsyls

Timeline for d1fv2a1:

• d1fv2a1 first appeared in SCOP 1.57
  
• d1fv2a1 appears in SCOP 1.71
  
• d1fv2a1 appears in SCOP 1.75
  
• d1fv2a1 appears in the current release, SCOPe 2.08