Lineage for d1fv2a1 (1fv2 A:865-1110)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371737Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 371755Protein Tetanus neurotoxin [49957] (1 species)
  7. 371756Species Clostridium tetani [49958] (8 PDB entries)
  8. 371762Domain d1fv2a1: 1fv2 A:865-1110 [60036]
    Other proteins in same PDB: d1fv2a2
    complexed with ceq, gal, glc, nan, nga, po4, slb

Details for d1fv2a1

PDB Entry: 1fv2 (more details), 2.5 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b

SCOP Domain Sequences for d1fv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv2a1 b.29.1.6 (A:865-1110) Tetanus neurotoxin {Clostridium tetani}
knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
ytsyls

SCOP Domain Coordinates for d1fv2a1:

Click to download the PDB-style file with coordinates for d1fv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1fv2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fv2a2