Lineage for d1fuwa_ (1fuw A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.1: Cystatin/monellin [54403] (2 families) 
Family d.17.1.1: Monellin [54404] (1 protein) Protein Monellin, B & A chains together [54405] (1 species) Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries) 
Domain d1fuwa_: 1fuw A: [60033]
Details for d1fuwa_
PDB Entry: 1fuw (more details)
PDB Description: solution structure and backbone dynamics of a double mutant single- chain monellin(scm) determined by nuclear magnetic resonance spectroscopy
SCOP Domain Sequences for d1fuwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fuwa_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiieigpftqnlgkfavdeenkigqygrltfnkvikpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpv
SCOP Domain Coordinates for d1fuwa_:
Click to download the PDB-style file with coordinates for d1fuwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fuwa_:
- d1fuwa_ first appeared in SCOP 1.57
- d1fuwa_ appears in SCOP 1.61
- d1fuwa_ appears in the current release, SCOPe 2.08
View in 3D