Lineage for d1fuwa_ (1fuw A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78425Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 78426Family d.17.1.1: Monellin [54404] (1 protein)
  6. 78427Protein Monellin, B & A chains together [54405] (1 species)
  7. 78428Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (6 PDB entries)
  8. 78438Domain d1fuwa_: 1fuw A: [60033]

Details for d1fuwa_

PDB Entry: 1fuw (more details)

PDB Description: solution structure and backbone dynamics of a double mutant single- chain monellin(scm) determined by nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1fuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuwa_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiieigpftqnlgkfavdeenkigqygrltfnkvikpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpv

SCOP Domain Coordinates for d1fuwa_:

Click to download the PDB-style file with coordinates for d1fuwa_.
(The format of our PDB-style files is described here.)

Timeline for d1fuwa_: