SCOPe 2.06: Domain d1ftfc_: 1ftf C:

Lineage for d1ftfc_ (1ftf C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
   forms trimers with three closely packed beta-sheets similar to the IspF trimers
   automatically mapped to Pfam PF01648

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries)

8. Domain d1ftfc_: 1ftf C: [60027]

Details for d1ftfc_

PDB Entry: 1ftf, 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 2)

PDB Compounds: (C:) acyl carrier protein synthase

SCOPe Domain Sequences for d1ftfc_:

Sequence, based on SEQRES records:

>d1ftfc_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Sequence, based on observed residues (ATOM records):

>d1ftfc_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamggfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Timeline for d1ftfc_:

• d1ftfc_ first appeared in SCOP 1.57
  
• d1ftfc_ appears in SCOPe 2.05
  
• d1ftfc_ appears in SCOPe 2.07
  
• d1ftfc_ appears in the current release, SCOPe 2.08