| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
| Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) forms trimers with three closely packed beta-sheets similar to the IspF trimers automatically mapped to Pfam PF01648 |
| Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries) |
| Domain d1ftfa_: 1ftf A: [60025] |
PDB Entry: 1ftf (more details), 2.05 Å
SCOPe Domain Sequences for d1ftfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftfa_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee
Timeline for d1ftfa_: