Lineage for d1fteb_ (1fte B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594189Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2594190Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2594200Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
    automatically mapped to Pfam PF01648
  6. 2594201Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 2594213Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries)
  8. 2594221Domain d1fteb_: 1fte B: [60023]
    complexed with so4

Details for d1fteb_

PDB Entry: 1fte (more details), 2.4 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 1)
PDB Compounds: (B:) acyl carrier protein synthase

SCOPe Domain Sequences for d1fteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fteb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

SCOPe Domain Coordinates for d1fteb_:

Click to download the PDB-style file with coordinates for d1fteb_.
(The format of our PDB-style files is described here.)

Timeline for d1fteb_: