Lineage for d1ft3a_ (1ft3 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789412Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 789418Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 789427Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)
  8. 789447Domain d1ft3a_: 1ft3 A: [60020]

Details for d1ft3a_

PDB Entry: 1ft3 (more details), 2.8 Å

PDB Description: crystal structure of truncated rhogdi k141a mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOP Domain Sequences for d1ft3a_:

Sequence, based on SEQRES records: (download)

>d1ft3a_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdwk

Sequence, based on observed residues (ATOM records): (download)

>d1ft3a_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
mvpnvvvtgltlvcssapgpleldltsfvlkegveyrikisfrvnreivsgmkyiqhtyr
kgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswew
nltikkdwk

SCOP Domain Coordinates for d1ft3a_:

Click to download the PDB-style file with coordinates for d1ft3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ft3b_