Lineage for d1ft0b_ (1ft0 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54687Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 54692Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries)
  8. 54701Domain d1ft0b_: 1ft0 B: [60019]

Details for d1ft0b_

PDB Entry: 1ft0 (more details), 2.6 Å

PDB Description: crystal structure of truncated human rhogdi k113a mutant

SCOP Domain Sequences for d1ft0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft0b_ b.1.1.5 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyriaisfrvnreivsg
mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdwk

SCOP Domain Coordinates for d1ft0b_:

Click to download the PDB-style file with coordinates for d1ft0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ft0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ft0a_