Lineage for d1ft0a_ (1ft0 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (24 proteins) 
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries) 
Domain d1ft0a_: 1ft0 A: [60018]
Details for d1ft0a_
PDB Entry: 1ft0 (more details), 2.6 Å
PDB Description: crystal structure of truncated human rhogdi k113a mutant
SCOP Domain Sequences for d1ft0a_:
Sequence, based on SEQRES records: (download)
>d1ft0a_ b.1.1.5 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyriaisfrvnreivsg
mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdwk
Sequence, based on observed residues (ATOM records): (download)
>d1ft0a_ b.1.1.5 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
mvpnvvvtgltlvcssapgpleldltsfvlkegveyriaisfrvnreivsgmkyiqhtyr
kgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswew
nltikkdwk
SCOP Domain Coordinates for d1ft0a_:
Click to download the PDB-style file with coordinates for d1ft0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ft0a_:
- d1ft0a_ is new in SCOP 1.57
- d1ft0a_ appears in SCOP 1.59
- d1ft0a_ appears in the current release, SCOPe 2.08, called d1ft0a1
View in 3D
