Lineage for d1fsxc_ (1fsx C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758570Species Cow (Bos taurus) [TaxId:9913] [46490] (8 PDB entries)
  8. 758578Domain d1fsxc_: 1fsx C: [60014]
    Other proteins in same PDB: d1fsxb_, d1fsxd_
    complexed with cmo, hem

Details for d1fsxc_

PDB Entry: 1fsx (more details), 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms
PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d1fsxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1fsxc_:

Click to download the PDB-style file with coordinates for d1fsxc_.
(The format of our PDB-style files is described here.)

Timeline for d1fsxc_: