| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (19 species) |
| Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries) |
| Domain d1fsxc_: 1fsx C: [60014] Other proteins in same PDB: d1fsxb_, d1fsxd_ complexed with cmo, hem |
PDB Entry: 1fsx (more details), 2.1 Å
SCOP Domain Sequences for d1fsxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr
Timeline for d1fsxc_: