| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (22 species) |
| Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries) |
| Domain d1fsxa_: 1fsx A: [60012] Other proteins in same PDB: d1fsxb_, d1fsxd_ complexed with cmo, hem |
PDB Entry: 1fsx (more details), 2.1 Å
SCOPe Domain Sequences for d1fsxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr
Timeline for d1fsxa_: