SCOP 1.69: Domain d1fstb_: 1fst B:

Lineage for d1fstb_ (1fst B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries)

8. Domain d1fstb_: 1fst B: [60009]

Details for d1fstb_

PDB Entry: 1fst, 2.7 Å

PDB Description: crystal structure of truncated human rhogdi triple mutant

SCOP Domain Sequences for d1fstb_:

Sequence; same for both SEQRES and ATOM records:

>d1fstb_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
lgrvavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikis
frvnreivsgmkyiqhtyragvaidatdymvgsygpraeeyefltpveeapkgmlargsy
siksrftdddktdhlswewnltikkdwk

Timeline for d1fstb_:

• d1fstb_ first appeared in SCOP 1.57
  
• d1fstb_ appears in SCOP 1.67
  
• d1fstb_ appears in SCOP 1.71
  
• d1fstb_ appears in the current release, SCOPe 2.08