Lineage for d1fstb_ (1fst B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765633Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2765638Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2765656Domain d1fstb_: 1fst B: [60009]
    mutant

Details for d1fstb_

PDB Entry: 1fst (more details), 2.7 Å

PDB Description: crystal structure of truncated human rhogdi triple mutant
PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1fstb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fstb_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
lgrvavsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikis
frvnreivsgmkyiqhtyragvaidatdymvgsygpraeeyefltpveeapkgmlargsy
siksrftdddktdhlswewnltikkdwk

SCOPe Domain Coordinates for d1fstb_:

Click to download the PDB-style file with coordinates for d1fstb_.
(The format of our PDB-style files is described here.)

Timeline for d1fstb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fsta_