Lineage for d1fsta_ (1fst A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375554Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2375588Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2375593Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2375610Domain d1fsta_: 1fst A: [60008]
    mutant

Details for d1fsta_

PDB Entry: 1fst (more details), 2.7 Å

PDB Description: crystal structure of truncated human rhogdi triple mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1fsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsta_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
nvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyragvaidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdwk

SCOPe Domain Coordinates for d1fsta_:

Click to download the PDB-style file with coordinates for d1fsta_.
(The format of our PDB-style files is described here.)

Timeline for d1fsta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fstb_