Lineage for d1fsoa_ (1fso A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49242] (8 PDB entries) 
Domain d1fsoa_: 1fso A: [60007]
Details for d1fsoa_
PDB Entry: 1fso (more details), 2 Å
PDB Description: crystal structure of truncated human rhogdi quadruple mutant
SCOP Domain Sequences for d1fsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsoa_ b.1.1.5 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyragvaidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnftikkdwk
SCOP Domain Coordinates for d1fsoa_:
Click to download the PDB-style file with coordinates for d1fsoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fsoa_:
- d1fsoa_ first appeared in SCOP 1.57
- d1fsoa_ appears in SCOP 1.59
- d1fsoa_ appears in SCOP 1.63
- d1fsoa_ appears in the current release, SCOPe 2.08, called d1fsoa1
View in 3D