Lineage for d1fsha_ (1fsh A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) 
Family a.4.5.31: DEP domain [63483] (1 protein) Protein Segment polarity protein Dishevelled-1 [63484] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [63485] (1 PDB entry) 
Domain d1fsha_: 1fsh A: [60006]
Details for d1fsha_
PDB Entry: 1fsh (more details)
PDB Description: structural basis of the recognition of the dishevelled dep domain in the wnt signaling pathway
SCOP Domain Sequences for d1fsha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsha_ a.4.5.31 (A:) Segment polarity protein Dishevelled-1 {Mouse (Mus musculus)}
eapltvksdmsaivrvmqlpdsgleirdrmwlkitianavigadvvdwlythvegfkerr
earkyassmlkhgflrhtvnkitfseqcyyvfgd
SCOP Domain Coordinates for d1fsha_:
Click to download the PDB-style file with coordinates for d1fsha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fsha_:
- d1fsha_ is new in SCOP 1.57
- d1fsha_ appears in SCOP 1.59
- d1fsha_ appears in the current release, SCOPe 2.08
View in 3D