SCOPe 2.07: Domain d1fsef_: 1fse F:

Lineage for d1fsef_ (1fse F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Germination protein GerE [63488] (1 species)
   single-domain protein homologous to the C-terminal domain of NarL

7. Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry)

8. Domain d1fsef_: 1fse F: [60005]
   complexed with gol, so4

Details for d1fsef_

PDB Entry: 1fse, 2.05 Å

PDB Description: crystal structure of the bacillus subtilis regulatory protein gere

PDB Compounds: (F:) gere

SCOPe Domain Sequences for d1fsef_:

Sequence, based on SEQRES records:

>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]}
plltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvellrm
gelel

Sequence, based on observed residues (ATOM records):

>d1fsef_ a.4.6.2 (F:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]}
plltkrerevfellvqdkvrnhisnamqklgvkgrsqavvellrmgelel

Timeline for d1fsef_:

• d1fsef_ first appeared in SCOP 1.57
  
• d1fsef_ appears in SCOPe 2.06
  
• d1fsef_ appears in the current release, SCOPe 2.08