Lineage for d1fsee_ (1fse E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45815Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 45824Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (2 protein domains)
  6. 45825Protein Germination protein GerE [63488] (1 species)
  7. 45826Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry)
  8. 45831Domain d1fsee_: 1fse E: [60004]

Details for d1fsee_

PDB Entry: 1fse (more details), 2.05 Å

PDB Description: crystal structure of the bacillus subtilis regulatory protein gere

SCOP Domain Sequences for d1fsee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsee_ a.4.6.2 (E:) Germination protein GerE {Bacillus subtilis}
lltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvellrmg
elel

SCOP Domain Coordinates for d1fsee_:

Click to download the PDB-style file with coordinates for d1fsee_.
(The format of our PDB-style files is described here.)

Timeline for d1fsee_: