Lineage for d1fsed_ (1fse D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308654Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 2308655Protein Germination protein GerE [63488] (1 species)
    single-domain protein homologous to the C-terminal domain of NarL
  7. 2308656Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry)
  8. 2308660Domain d1fsed_: 1fse D: [60003]
    complexed with gol, so4

Details for d1fsed_

PDB Entry: 1fse (more details), 2.05 Å

PDB Description: crystal structure of the bacillus subtilis regulatory protein gere
PDB Compounds: (D:) gere

SCOPe Domain Sequences for d1fsed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsed_ a.4.6.2 (D:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]}
kplltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvellr
mgelel

SCOPe Domain Coordinates for d1fsed_:

Click to download the PDB-style file with coordinates for d1fsed_.
(The format of our PDB-style files is described here.)

Timeline for d1fsed_: