Lineage for d1fs0g_ (1fs0 G:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123773Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 123848Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
  5. 123849Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 123850Protein ATP syntase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 123861Species Escherichia coli [TaxId:562] [64070] (1 PDB entry)
  8. 123862Domain d1fs0g_: 1fs0 G: [59999]
    Other proteins in same PDB: d1fs0e1, d1fs0e2

Details for d1fs0g_

PDB Entry: 1fs0 (more details), 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli

SCOP Domain Sequences for d1fs0g_:

Sequence, based on SEQRES records: (download)

>d1fs0g_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Escherichia coli}
kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahgnleykhpyledrdvkrvgy
lvvstdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvt
gmgdnpslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpasdddd
lkhkswdylyepdpkalldtllrryvesqvyqgvvenlaseqaarmvamk

Sequence, based on observed residues (ATOM records): (download)

>d1fs0g_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Escherichia coli}
kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahykhpyledrdvkrvgylvvs
tdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvtgmgd
npslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpkhkswdylye
pdpkalldtllrryvesqvyqgvvenlaseqaarmvamk

SCOP Domain Coordinates for d1fs0g_:

Click to download the PDB-style file with coordinates for d1fs0g_.
(The format of our PDB-style files is described here.)

Timeline for d1fs0g_: