Lineage for d1fs0e2 (1fs0 E:1-86)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115743Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
  4. 115744Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 115745Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 115746Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
  7. 115750Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)
  8. 115754Domain d1fs0e2: 1fs0 E:1-86 [59998]
    Other proteins in same PDB: d1fs0e1, d1fs0g_

Details for d1fs0e2

PDB Entry: 1fs0 (more details), 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli

SCOP Domain Sequences for d1fs0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs0e2 b.93.1.1 (E:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

SCOP Domain Coordinates for d1fs0e2:

Click to download the PDB-style file with coordinates for d1fs0e2.
(The format of our PDB-style files is described here.)

Timeline for d1fs0e2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fs0e1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fs0g_