Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (3 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (247 PDB entries) Uniprot P35963 57-155 Uniprot P04587 69-167 Uniprot P03366 69-167 Uniprot P03367 69-167 Uniprot P03368 69-167 Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
Domain d1fqxa_: 1fqx A: [59994] |
PDB Entry: 1fqx (more details), 3.1 Å
SCOP Domain Sequences for d1fqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqxa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d1fqxa_: