Lineage for d1fqqa_ (1fqq A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890710Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 890711Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 890712Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 890726Protein Beta-defensin, BD [63384] (7 species)
  7. 890738Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 890760Domain d1fqqa_: 1fqq A: [59990]

Details for d1fqqa_

PDB Entry: 1fqq (more details)

PDB Description: solution structure of human beta-defensin-2
PDB Compounds: (A:) beta-defensin-2

SCOP Domain Sequences for d1fqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqqa_ g.9.1.1 (A:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fqqa_:

Click to download the PDB-style file with coordinates for d1fqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fqqa_: