Lineage for d1fqfa_ (1fqf A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) Protein Transferrin [53897] (2 species) Species Human (Homo sapiens) [TaxId:9606] [53899] (10 PDB entries) 
Domain d1fqfa_: 1fqf A: [59989]
Details for d1fqfa_
PDB Entry: 1fqf (more details), 2.1 Å
PDB Description: crystal structures of mutant (k296a) that abolish the dilysine interaction in the n-lobe of human transferrin
SCOP Domain Sequences for d1fqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqfa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens)}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfadsahgf
lkvpprmdakmylgyeyvtairnlregtc
SCOP Domain Coordinates for d1fqfa_:
Click to download the PDB-style file with coordinates for d1fqfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fqfa_:
- d1fqfa_ is new in SCOP 1.57
- d1fqfa_ appears in SCOP 1.59
- d1fqfa_ appears in the current release, SCOPe 2.08
View in 3D