Lineage for d1fqaa_ (1fqa A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846244Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 846257Species Escherichia coli [TaxId:562] [53863] (46 PDB entries)
    Uniprot P02928
  8. 846263Domain d1fqaa_: 1fqa A: [59984]
    complexed with glc, glo

Details for d1fqaa_

PDB Entry: 1fqa (more details), 1.9 Å

PDB Description: structure of maltotetraitol bound to open-form maltodextrin binding protein in p2(1)crystal form
PDB Compounds: (A:) maltodextrin-binding protein

SCOP Domain Sequences for d1fqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqaa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
aieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOP Domain Coordinates for d1fqaa_:

Click to download the PDB-style file with coordinates for d1fqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fqaa_: