SCOPe 2.01: Domain d1fq1a_: 1fq1 A:

Lineage for d1fq1a_ (1fq1 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Kinase associated phosphatase (kap) [64049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)

8. Domain d1fq1a_: 1fq1 A: [59982]
   Other proteins in same PDB: d1fq1b_
   complexed with atp, mg

Details for d1fq1a_

PDB Entry: 1fq1, 3 Å

PDB Description: crystal structure of kinase associated phosphatase (kap) in complex with phospho-cdk2

PDB Compounds: (A:) cyclin-dependent kinase inhibitor 3

SCOPe Domain Sequences for d1fq1a_:

Sequence; same for both SEQRES and ATOM records:

>d1fq1a_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}
edeqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfct
rgelskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihs
ygglgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
ssr

Timeline for d1fq1a_:

• d1fq1a_ first appeared in SCOP 1.57
  
• d1fq1a_ appears in SCOP 1.75
  
• d1fq1a_ appears in SCOPe 2.02
  
• d1fq1a_ appears in the current release, SCOPe 2.08